SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|59022|fgenesh1_pm.7_#_172 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|59022|fgenesh1_pm.7_#_172
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000097
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 64-104
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000136
Family Zn2/Cys6 DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|59022|fgenesh1_pm.7_#_172
Sequence length 627
Sequence
MFRCAHCDKSYQRKAHLQRHEVTHTGRAATACPFCRKCFLKPEVARRHSKACATRHNKQP
APAAKPGRKRQSCDQCFSMKKACDKGLPCSRCLSLGLQCTFESQQAFSPTDSNLTDSSLL
SSIQSSSTPKVDTQFSFLRHFTDPSVEKDRLAIGTTAECSVPRNLENLYSHLEDALIPLD
SMATWFGDFSSMGSFFQPPLTTDSHVPADFLSSEPGPTKLSGQLNELLMELAETSKSMKI
ESVDNTQLLYDTPQLASLFTVSNIAIFVSVFFHSLHWHLPVVHFPTFDPGNVSNPLLLSI
FLTGATYSNSLEDAALLPRLLDVAEEYIFRSVTALSAQSTLPPHKITSQNSMIQLIQAAL
IIEMLQFGQERVETRRRIRIIRHPSLVSLMRCLGIFHLKRSMAPTSNNGEDGSWKLLVAE
EVCIRLASWVFLADGFLTLCFRNRPSISIFELDCSFPWKTELWEAEDASTFNRVAMDYEA
ELPLPSIREAVRLLLDNPDPGPIPSRLSLSAEHLLIMIYALNSLAFMARVDFFGSVPLEK
IRSAANNWKQIWDSASTNNEQKLLLGYPKHAKELWLLLTVTLDIASQRTNIPYLDSDSAA
TDDLGKLNEFIKWCSRYMTTPSALEMG
Download sequence
Identical sequences A0A1L9TDN0
jgi|Aspsy1|59022|fgenesh1_pm.7_#_172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]