SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|730870|CE515832_4128 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|730870|CE515832_4128
Domain Number 1 Region: 53-95
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000127
Family Zn2/Cys6 DNA-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 25-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000347
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|730870|CE515832_4128
Sequence length 803
Sequence
MSFTLPDAPSTPPVHVDRGRSQARYSCAICDRQFDRRDTLSRHAQIHARRRNQPKSRRKA
CIPCSRAKIRCECEQPSCSSCIKRNVPCTYNANRHSNERLPPGPACTTVQPTPQEPFQGT
MGENASTSQLYPMLDLVQPPAGHTTNQSPDDLPRDGLFNPLYMPDYSGFSSNLEWVFDSN
SHDLNTLLMAEQPAMGYMGIPFTSPTQPLTTLPISSSHSATASKSDRDSWIQGNLPTPEL
RDVPPPDDPWPMELRARSMQSVVLPPLGNAAGTHRTLRHFTTGEVCPSVHHALQRCIQLP
SERSPWKPIEIESFPTEETVNHCIDMYFVHFHQQFPIIHRPTFDPGESLIVTLAMVTIGA
CYSDLDGNEAFAIATSELNRRLILYMSEYDRRFVRTEPLLTAQLLQALHGYGSGNERLFE
LSESCRSSLVYYAKYMGLFRDPEPQPPASDSLEDSWKEWIRQERHRRLGWAVYEYDTCIA
LLQNDRPLLNIADAAMTLPSSMKHWDAGSAYAWSSLQPMVNLQPTGPRLQPIIKSLLDGN
RNVAETVDNERHRIVILLSLSRMMWSLKEVATTPMDSLIGDRLEEVRQKVQDTVDWFWQF
PVSLSHTHTKTEVARSVHAMHIVHLAHIYGAGTLMNFYYSFLRNSLLQRTEDGRVAEALM
KQWASENVRLARVVAFHCAQILALARRFPENMSMEPFLVFHAGVLLMTMGLVLPATQPSQ
GPGLKIDHLGPVGDPTFFKILNWAREGGNVVVGVHGVPVLCCETGWKQVLDETAEILTGL
KVWKLTQALLKVVLAIRNGLDAN
Download sequence
Identical sequences A0A1L9TLR9
jgi|Aspsy1|730870|CE515832_4128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]