SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|73765|estExt_fgenesh1_pg.C_200084 from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|73765|estExt_fgenesh1_pg.C_200084
Domain Number 1 Region: 17-69
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000855
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 84-120
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.00000702
Family Zn2/Cys6 DNA-binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|73765|estExt_fgenesh1_pg.C_200084
Sequence length 826
Sequence
MPPTSGTRLPMETEASKPWACEYCSEEFSRKEHLRRHESRHLGLRPFQCELCSRTFSRRD
TLIRHRLIHEPDNAGDCRQWVCGRPRSQAACRNCAQAKQRCNGAWPCLRCARKNLLCQPV
AQGATRPQTAAPVSTSMSASLSGHGHDTLGQQQLEMPTTAFSMQAASEADIWPLDVPECG
PEQNLGSQDTQNTLFTHVGQFATDIVACPRQEDSDEQSGMSQSTGTTIDQPFAVPTSMGS
SPTTCDFAAQEQRSVSKKCCCVRFPEGGPEDDEVIAAEDFGHVANIPETKYRQILEFWRT
QQCARCKASCAETSFVSLPLLNTTIQLYYEYYDPWMPFLHPSAFDDGRISCVLVLAVASV
GCQYSDVKNSEAYVLGLQDLLQGALNTIAGENSSLDKIALVQCLILRDVGLLLSGHQDDI
RTSQYQKNTLATLSQSMALSGDILEDNSPSNCSSELYIAWHRWVLSETRRRVVYCTWVIE
CFHLVLRDVPPCLNLDHFRIPLPSNDELWRSSPQEWHRTFFRSTDTSEPWSLRTVMVNPL
CLDQLFDNTSQLRDLVIFLTFYVEERRVLGSSQPWFAPERILDVRGRAFFEWPDDLVSLR
TSTDRHCDPIIDRFKGLVTVDQSAPNQIMKLVYHTINIIRRTPLRCLYALTGWQANFEQM
GIAAASLSRWMQQNPTFARESLLHAAALYNDLYDAGSGAGIHHLAFLIATLYIWAYVSLN
GEGSGQLDISNRPCHPLRLDKPLSAYEWRSWVLGISDAPIYVKGVGMLVNQESALRVLKG
FRKSLSRYRSWPSLRYGLLYAVTEIIEGRFASYAPRMMHGRRSLPL
Download sequence
Identical sequences A0A1L9SZE9
jgi|Aspsy1|73765|estExt_fgenesh1_pg.C_200084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]