SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|87523|gm1.4206_g from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|87523|gm1.4206_g
Domain Number 1 Region: 120-448
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.63e-67
Family Glutamine synthetase catalytic domain 0.00022
Further Details:      
 
Weak hits

Sequence:  jgi|Aspsy1|87523|gm1.4206_g
Domain Number - Region: 13-108
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0248
Family Glutamine synthetase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|87523|gm1.4206_g
Sequence length 450
Sequence
MDNQASLAQLDANAQEVDFVWVLFTTYIGTNLVRIVPMPAFKRLLETNQGISVPKTVLHI
LPHDNVADGGTSVGSFFLQPDPRSLVSPYLDPNKAIVMSTWADKENKPMGECARYKLDTL
TRSIEQKAKCSVLVGFELEFCILRQTILPGGQVEYEPVNVDHAWCTMSMTREAELLLGVL
EEVVLALQDLGIMVQQFHAELGPDQWEFILPPDSPLKAVDALVLARQVVMKIASKHGYRA
TLHPRLSAEKPGTGAHVHISLNSPELNSSSDQVDLSTVESFFAGILDNFPSVSAFTLPQE
ISYERVLGGIASGGEYVSWGWENKETILRRICNNRFEVKMMDGLANPYLALCALLAAGLD
GLLQGSPLRAGPCPVEPAKMSDQERAALGIEAKVPTGLAESLENLETNERLRLALGDSLV
STYLAVKRGELKVVQRKTPEEQRAWFISRY
Download sequence
Identical sequences A0A1L9TNG6
jgi|Aspsy1|87523|gm1.4206_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]