SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|93099|gm1.9782_g from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|93099|gm1.9782_g
Domain Number 1 Region: 16-68
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000236
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 83-122
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.0000000497
Family Zn2/Cys6 DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|93099|gm1.9782_g
Sequence length 903
Sequence
MPDDSPLDSKSRQGYFQCGFGSCRKSYNRADHLIRHVRSHTREKPYVCQVCNKGFSRPDL
LKRHAAGHSHSQDGKRRRTTSYSKNGRVSQACKACATSKLKCDEEKPCRRCRDRKLFCDY
NDAGVNDAPEFAEQQGSNDEQLDEEFSPMESSQDTFSPPLHPNLNTQPLVTPNAQMDTFL
PPLNPGPVETVPDSYDGTARPQPDFTTQTVSPLVDHESGVFSVDGTFFPEFIPDSLVSLS
RPGELVDPSAFPPNDYYAHRLYDHNLNFDFDLTEVDFGLIDFYNSRGSANPAVQPEDPSD
RLDADSGIALGAEAYQRSSLSAWQPAHEDHAFADQAYLSVPKSIDSPETSVRSERQILSE
RLSPGSRDLIFGMVLQTSLGANLTRIMKSFPSTELLDSLIQDYFAHQSQQVDSWIHGPTF
HPNEQSPDMLGVLAAAAAVRSTIPTIRKLGYALTEVVRVQMAQKYETDNRTIRELRASQT
YVLVIDIGIWSGSGRRTEIAESFQQPVLTMLRRGLRFRRSIYSTIIPTLEDSPEMLDRKW
RDWAEQESFKRLAHHLFLHDAQSALMLNINPLISYADLELPFPMIRPLWEAKSATEWRDI
YLASATPGQERLPSLVDTLRDMSQWKGRVDYQLSGFVILHGLSALINEYHRLKFISQGNS
KHWNALVINSRQQELSQVLEHFRMISHEWANMPGPEISLVYEVMSMLVFMSVEDLQLFAG
KEDKKEARRVYHSALEWINSVDSRRAIWHAGQVLRAAKAMPPGALTGFLAVGVYYASLAF
WSYSVVSKARESKMAANVDIASPNSDSNSALRDRYPMVFLDGDETNDVHKFISLGRGCPA
LHGFGIRGPAVVADPGRVMDVAQGLLRADAPHDALPTLVQGLCQLMNDLGNAARSSATAG
VGN
Download sequence
Identical sequences A0A1L9T6R8
jgi|Aspsy1|93099|gm1.9782_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]