SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Aspsy1|94618|gm1.11301_g from Aspergillus sydowii v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Aspsy1|94618|gm1.11301_g
Domain Number 1 Region: 19-70
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000101
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 86-124
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000137
Family Zn2/Cys6 DNA-binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Aspsy1|94618|gm1.11301_g
Sequence length 814
Sequence
MSSSIPPPRLPRKAKNQEVYACDRCNASFRRQDHLDRHYRAHTKQRPFACPVCSRGFARR
DLMVRHKANHSRSTNIRRGSEDSSSNIKYRVAQACRRCASSKLKCTDQKPCQRCQKKNLP
CEPADVPDPLVEHGASGDNSNAPFYSSRGQQDSAASESTITSIQPLWNSLSLLPFGGEDC
SFGTGDTLDLGDMDFSFLNSISTFTNMDNPCVPVVPPNETMSPIMPMRSQVYKLSSVVQG
WMPLSTENSHMEQAHLSINGEVPGFTPQADTTSILTQPFPHFVRDRILNMVFNAYSDRKP
GIVESFPSSEVLFKLANRYITRKMVRQINDLIHIPTFDWSSRRPELIAAMIAMGAVDSPS
VTLRKFGFALQLTVRRATMQRYEEDHTTMRALDMAQAFLLQQYMGIFSGISRKIGLAESC
FMIVPTIISQARRLLLLDAEPYFEAALESDCSEKLDSIWRRWCEQESMRRLIYHSFVLDC
QTSITRNTNPTLSYASIDIPLPCPKQLWHAETAAVWKDEVLKLSAPAPPPSLKELIQNPQ
LLGTCKDRVEISFMQSVYLNGMWSMVREYRQLSSIAAGSSTWNTLVLTSRHAELQSVMKL
FPLNSCGAAPAATSGALAPEIAFLYNLVSMHLHVSFNDLQPSSVGESFREEFKTAVYAES
WMQGADSRYAIWHAGQIVRAAKAMNRGTLCDVYPIAFLQAVIVLFVAGGFSCRHHAQIPA
VYTDATTSVPATELQNISLNTAQTPQLDLYLAYGNGQPGLTVEADSFLPLHDCKSVVEVL
KRVIEENWLPDLPPWGTDEVIRVLDDLCAVFTGL
Download sequence
Identical sequences A0A1L9T1T5
jgi|Aspsy1|94618|gm1.11301_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]