SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL006331-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL006331-PA
Domain Number 1 Region: 269-325
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.66e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 6-47
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000102
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL006331-PA
Sequence length 325
Comment pep:novel scaffold:Hmel1:HE670395:55906:56883:-1 gene:HMEL006331 transcript:HMEL006331-RA description:""
Sequence
MTSQLSVLKLYGTVVDDVIAGVRDCFLDDGVDEQILQELKQLWKTKLAASGAMDPPQPEV
STMTMTPPPALQNFQKANGSHLIPKRTETAPPGSSHHSSGEHGAPASSAHPHHVLDPNNK
VPVQLTLPAQPGVPGSQPRSFTIQIPASALNGNKLHQVLTGPIINATISLPQPLAATLLQ
QHINSALAGQQNEFDGGGGGRSGAAPFSLDGALDSSDDEGSNVGDGSEDGGGDDDEDEES
AEERAEEEEEERDESGGAEEEPLNSGDDVSEEETGDMFDTENVVVCQYDKITRSRNKWKF
YLKDGIMNLSGKDYVFQKANGDAEW
Download sequence
Identical sequences HMEL006331-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]