SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL010606-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL010606-PA
Domain Number 1 Region: 1296-1417
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.45e-31
Family Single strand DNA-binding domain, SSB 0.0001
Further Details:      
 
Domain Number 2 Region: 1423-1450,1575-1646
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-19
Family Single strand DNA-binding domain, SSB 0.0055
Further Details:      
 
Domain Number 3 Region: 1198-1291
Classification Level Classification E-value
Superfamily BRCA2 helical domain 2.62e-18
Family BRCA2 helical domain 0.00087
Further Details:      
 
Domain Number 4 Region: 1663-1786
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000617
Family Single strand DNA-binding domain, SSB 0.033
Further Details:      
 
Domain Number 5 Region: 1450-1563
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0000000000497
Family BRCA2 tower domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL010606-PA
Sequence length 1973
Comment pep:novel scaffold:Hmel1:HE671108:10811:21800:-1 gene:HMEL010606 transcript:HMEL010606-RA description:""
Sequence
MEDREMEDFVESFKNSLQKQNQHKSISLYHDDKKSNSNITNFKAKDVFFNISQQVKAMHS
ADTTINVKNNMKLKEFKRKDFIPVSMISNDQLPKVTQANKFDTQCVSDTELIDIIEKAEA
LINKENDISQKFDNNFHYTNISFEANNKEKIPKIHKIDTTNLKAINKNLNSYIFEPFSEN
RTYNDMIKEKSDTVNILSVEQNTHAQMDNIIKTQNNSLDIIFNNNEEISNSPIINISNSY
IMKSKTPSPLIFGLDSFDKFEAIAMPVIEKNLETSVAKQIIHSQVISNELYIKRHTEPVL
IDRDKSLSPILTIRKKSTDRSITKIKNGRFTIEDSILFSSDEENEIKNEELPLTCALKTS
FYNEHDLNETMYVGFQTASDKSIQICSDSYNKAKSLLCVKSIDIPLTKLVEVMDSSNNIV
NKNTQKEIKGNKISIFNHNLSDSATKQSQQNEDESKSVLRKSNNICDKNNIWNESTTVIA
SNNKEIKLFPVSPSCEEKIEVRNNNLYNNISQDILLSTGAVSNIPVLEKEQVNIDDNIIK
EFETNFLVENNDITNPFENKKNNPALKAPESNINDKVFPSETEQALIQTKGFKTANKNKI
NTHKLDEIKDIFKDIDLTDIGIGLDDYKENCVNNIDTSATASKNFIGFQTASHKSIKISE
QALANTKKIFQDIKNDDTTHAFGSNIINKKNRNYEINTLNTEETSSKPLYPINESKTVLC
SYLNMTNNNNSYLNKELKQKNDKVKETPKFVGFQTANNKPVTISKEAFAKSKKIFQDIEK
EIPANSENNIKNFSDKFQRFQTDNKAMAISKDAIQKSNKMYDAKEYNVDIQCLIKENDSI
EKFQGFKTASNKPVQISKESLAKSKNIFQGIDCSDDNLKEENQKNKMDPNRRPKINVGFH
TASYKPIVISNEALAKTKNIFDNIDIINNNSNKNDNFDIQNKFQGFRTLSKSKHIFQDVE
MDENLEHNFDKNKANTNFGGFKTASSKPVHISETALIKSKELKNINESNTKKDTVSEYSA
FGGFQTASNKKINVSEKALYKSRKLFEGINITEEKETIKVGCNDDLFKKPCLDNVNDESL
DKATKTNDNNVMNIDDLMNTEVIKDLEETMCTEDFIKENTPSNKRSSSPILSCPRAKKRK
KFEMPIIIKPVKTVGSENNENRNIMHTFDSNYKTHKQLNLQNIIEIEKQNCSNTEIDSNI
SKFRFDTLLQFEFGKKRNDIDNDVWNTDKIQQLFTDSVNKRMIPKGWIENHLKLIIWKLL
SYEIVFPKTMNNVCTIKNVLNQLKYRYDRELYNVERPALRKILEKDEISSKRIVLCVVGV
YVDSSYVNSIAHPTQNLELLLTDGWYTIMSSTDAMINKLIFDGKITVGTKLVIHGAELLN
CEQGVAPWENTSAIRLKIFGNSTRRAKWNARLGFHGNGAMLSHLSSVKMEGGKVSRVKVF
ITRVYPMLYVERFDDGSTVTRSERLENLYQIKYENEKQNQLEKLYEEVEKYSDKESQDSE
SLDTERDLDSGTQLCKLMKMSKDPIEFRAGLTHSQIKLLQEHSSKERDKLIEKLQQKVQE
MVKKRGLDVNRIVVPLLKMRVADLNNKSNHITKAMITIWRPNESLLDLIKEGTWIEIFNI
VPTSIRYSEMALSAGRQSIFKKAKLKENDSLKSITQTLKRTPFTLKDLQKPITIDYNEID
TFGFIFLIEPSTKEYEGSKQLFQNVYISDEYKNVIAINFWGGIKKFGFENILETGQIVSC
VNLQRRHGSNRKCSQQFRATEFTYFTKTCKIDMLRIMTDKFSRKLSSLDKKLFIEECVVV
KNNFANTKHGNTHFSPYRLNNSEYNITKNKIFIDSPVNKCVDANLTGLDFESSFKETDTK
ELSPKTVRRKRKVDEKIAKLEMYGEPPPLQPIHIINKSNIINNSYRSPLLIKNNYNIQNA
SIMNMSKNLSSPVCLNRAYVKNINPVKLNFSNNNMSEDPFADEFEGSPPLSLE
Download sequence
Identical sequences HMEL010606-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]