SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL006880-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL006880-PA
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-29
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 2.67e-24
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL006880-PA
Sequence length 198
Comment pep:novel scaffold:Hmel1:HE670499:10784:11380:1 gene:HMEL006880 transcript:HMEL006880-RA description:""
Sequence
MSNTGEQLTLARDIKRAIELLEKLQQSGEVPATKLAALQKVLQSDFLNAVREVYEHVYET
VDIQGSADIRASATAKATVAAFAAAEGHAHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVADRHGGLKRGDQLLSVNGVSVEGENHEKAVELLKQAVGSVKLVVRYTPKVLEE
MEMRFDKQRTARRRTNYN
Download sequence
Identical sequences HMEL006880-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]