SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL013207-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL013207-PA
Domain Number 1 Region: 772-897
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000149
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 2 Region: 1047-1096
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000126
Family cAMP-binding domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HMEL013207-PA
Sequence length 1256
Comment pep:novel scaffold:Hmel1:HE671336:257495:273377:1 gene:HMEL013207 transcript:HMEL013207-RA description:""
Sequence
MYKTNDCLYFSKAAEFERLLQAKSVAGNVMTDTSKTVICLDLASAVYGVDLDNKTAIKYS
GLKGPSYANCRKVIENLLELNSDQLSLSLLCASLQCSGVQSLAEKILEEYQREIDLNLPQ
YVCMAVFQACSTLIVFINKVKAANRTQNGSEEIVFDDPYRPTLAYPQYLPIFFLISILLI
GVVIRAVMLWTSMCVPYRVIMFSFGGIAGFLANRHPSIKPIVQICYIDVDLLLILFLPIL
IFYTSYSVDSHSFWKSFPQIFLVGVPGAVLTALMVAFMAYNLIESSWNFPTAFLFGVICS
PIYPMEVVKQLKEMSKGKYVSVLLLGEGLIGDATAMIEFTAVFGYLALALTSASQISLLL
LRYAGGGALLGFVTGKIISVMLTLTYYDLLCVVTVTLGGAYLTFYIGEKYFYVSGFLATV
IAGVMVSKSKSTLAADVEQVAAHFWHILVFVVNTLIFTMVGVVIFDKLSHVISVRLVALV
FVTYTTVYFSRLMVYAMMTPILRHIGYGISWQHSLSCVWGGLRGPLSLCLALIVLQTPTV
EDAGEIFIIQTAGLVILSLVVNATSMQRILKILGLAEISLAKKANMTNCVKRIMLTRDRC
ISMLKMDKFLADANWELKKCSNYYVVPRIKVIAGTNIKHPYQLQMRDEDSDDDTYMGYRY
TTCPDCEREIPNEPTKKEFAEMMREANQRVLKAMKISYWRQYEHGKISKDGVRTLVQAVE
VAADADDARVNLDQLAALWRPKLVDMLMPDPANAQVPRHEWRQLCYRMVSNVWFDGFIYV
MILCNTPVILCEVLMKPPVSLTLMITIKSLNLFFYIIYVFEMVVKMLALTIRGYFKSHWN
KLDFAIIVMATGDLFLDVIDALTPWDKWNNLNSSVLTATKLLRMLRFLRLCKLARVSVPK
IMAYIDRMIDIQLAFGYDVGKGFVTGEQEVCSLLPQLVDNQQIQETLYNKLETDRLAVTR
QLGLLQRDRPWTAITVKTRQATTSTLNIMILDTMQLKEEGFLDEVEYRLLVNAIQEKVQL
CRHKGSLVAPSSPETQLRAVSWLQGNERVADFFIENSEIRNYNINDILISRGDQPKGLYV
LVSGLCEATYTPPGEDIDEAIPNYEFRTDLKFSEPSKDYIVSGNAIGVLGVFVVNELMED
IILLDGICQDMATREVFQPPCYIPRTVHRLLFPKSSQLIVSNSCPETKLLIVPAKDTDEL
DIMEDELDDLQCELVIFYFFMETNKKTQDQKIYNTMLSKNKRGSTEKNTNNSNKHN
Download sequence
Identical sequences HMEL013207-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]