SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HMEL013473-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL013473-PA
Domain Number 1 Region: 148-219
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-19
Family PDZ domain 0.0014
Further Details:      
 
Domain Number 2 Region: 204-271
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-17
Family SH3-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 66-112
Classification Level Classification E-value
Superfamily L27 domain 0.00000203
Family L27 domain 0.0046
Further Details:      
 
Weak hits

Sequence:  HMEL013473-PA
Domain Number - Region: 11-51
Classification Level Classification E-value
Superfamily L27 domain 0.033
Family L27 domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HMEL013473-PA
Sequence length 271
Comment pep:novel scaffold:Hmel1:HE671864:4074:10138:-1 gene:HMEL013473 transcript:HMEL013473-RA description:""
Sequence
MDHSTQSWDPALMRLLTSLKEVQSGGEDVAFLSELLQSKQLHALVQVHNKIVAAQCKDDK
FYPLLSNAMQVTLEVLQQFSEIVTNSSEFEELLKLLQKPHFQVIAQKDYYPHLPDVPLDA
DDEEETVKIVQLVKSDEPLGGAQSAEPIVGATIKTDEETGKIVIARVMHGGAADRSGLIH
AGDEVIEVNGISVENKSPADVLSILQSSEGTITFKLVPSFGKGGSRESKVRVRALFNYNS
SEDPYIPCKEAGLNFMKGDILHIVSQDDAYW
Download sequence
Identical sequences HMEL013473-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]