SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HMEL015618-PA from Heliconius melpomene

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HMEL015618-PA
Domain Number 1 Region: 279-416
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-27
Family cAMP-binding domain 0.0023
Further Details:      
 
Domain Number 2 Region: 159-256
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000628
Family Voltage-gated potassium channels 0.046
Further Details:      
 
Weak hits

Sequence:  HMEL015618-PA
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00544
Family Flavin-binding PAS domain 0.011
Further Details:      
 
Domain Number - Region: 489-533
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0576
Family cAMP-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HMEL015618-PA
Sequence length 847
Comment pep:novel scaffold:Hmel1:HE671518:208838:224575:-1 gene:HMEL015618 transcript:HMEL015618-RA description:""
Sequence
GTPFWCLLDIVPIKNEKREVVLFLASFKDITNTKMAAMNTNEEFDSGAAVRPSAGVVTLA
LSPFVPAAALLGARFRAESSCLLPDPNGNLDPEAPSPANMGRRRSRAVLYQLSGHYKPDK
MKTKLKLNNVSKNLLHSSDPPLPEYKTSAIKKSRFIISHYGVFKTFWDWLILIATFYVAV
VVPYNASFVDEGHPRISVTSDVVVEALFIVDIVLNFRTTFVSKKGEVVSDSKAIALNYIR
TCLVAHWLACIWFIIAEKEIQYHRNESWDLAIIQRMYSRRSMYQTKWRDLKDFLTLNQVP
KELKQRMQDYFQTMWSLNHGIDIHETLKEFPEELRGDVSLHLHREILSLPIFEAASQGCL
KLLSLHIRNNFCAPGEFLVHKGDALTYIYYICNGSMEVMQNDMVVAILGKGDLVGCDMNT
HLQAYNGTGTSQSNNPDVVVKSSSDVKDVTYENSVLGKGDLVGCDMNTHLQAYNGTGTSQ
SNNPDVVVKSSSDVKALTYCDLKCINMVGLFEVLRLYPEYQQEFIHDIQHDLTYNLREGY
EAEQESDGNGHPSLTLPSISEDDENAAEDNALSPKKPLLSNSPRHAKFRSDGQQRLTHRE
LRERIERQRSVATPKITRADSLEGLNLEMHNTRSSVDRLDTQVRNAIQALQEMTGPVWHA
AHSNPNLQWNAPPNQLARSCSHPPDVFCWDQQERPLSPERPKINRCTQTEPFLHCVTQYI
MDHPATVMLLLGLDPMANMGPVMQPTVEYYDSRSRRPSGLEQIIESENGSQTPSSTTSDR
AEPARSPNESTAELEQPAQVKRLVDKDKFPNLKRSRYSASDLSEVTERLLPAKTQPSSYS
LKNNINS
Download sequence
Identical sequences HMEL015618-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]