SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IC33419AbApep6920 from Heliconius numata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IC33419AbApep6920
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00000000000171
Family Insect phospholipase A2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) IC33419AbApep6920
Sequence length 123
Sequence
PKSDGCGPLGFEISSEYLPIEQMTKCCDLHDICYDTCNSGKEVCDLEFKKCLYNYCDTYK
SVNVAGDAITKGCKGASKLLFTGTLTLGCKSYLDAQKNACYCPATKISIKNTPLVKMNSN
TIQ
Download sequence
Identical sequences IC33419AbApep6920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]