SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for IC33419AbApep2010 from Heliconius numata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  IC33419AbApep2010
Domain Number 1 Region: 139-272
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 5.53e-28
Family Insect phospholipase A2 0.0000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) IC33419AbApep2010
Sequence length 274
Sequence
MTQRTLSPLLLLKQTLYQCIFGFAGSVVESVVESVAERVVPKGLYDLFKRMQRQNELLEA
EKLRSREENGGIGQFTRGVIKTISTGLSRPFSQLMAGVRDIGSLDSDRGFINSLASGVTS
VANVANSMVDVFKDRVEAIYPGTIWCGDGHSAQARSSDLGLFFFTDTCCRQHDACKMYVL
AGETKFGLTNTGLFTRSHCSCDAKFRECLRKTNSLVSAQIGLTYFNVLGPQCFRKAHPIV
RCVRRTRITSLKCEEYELDYSKPKMWQWFDNETY
Download sequence
Identical sequences IC33419AbApep2010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]