SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|10047134|ref|NP_064525.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10047134|ref|NP_064525.1|
Domain Number 1 Region: 191-356
Classification Level Classification E-value
Superfamily PH domain-like 7.93e-49
Family Phosphotyrosine-binding domain (PTB) 0.0019
Further Details:      
 
Domain Number 2 Region: 32-103
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.89e-19
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 3 Region: 106-169
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.49e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|10047134|ref|NP_064525.1|
Sequence length 414
Comment ankyrin repeat and sterile alpha motif domain-containing protein 1B isoform c [Homo sapiens]
Sequence
MMWQCHLSAQDYRYYPVDGYSLLKRFPLHPLTGPRCPVQTVGQWLESIGLPQYENHLMAN
GFDNVQFMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLD
SIELGDYTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQK
PPRSITLRTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKE
LRGTESTQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNIS
CAAQDPEDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARK
GGHSSTLPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF
Download sequence
Identical sequences A0A2I3G4G8 A0A2J8N0G6 A0A2J8XMN1
ENSP00000448993 ENSP00000448993 gi|10047134|ref|NP_064525.1| NP_064525.1.87134 NP_064525.1.92137 XP_009002684.1.60252 XP_009424344.1.37143 XP_012355589.1.23891 XP_017366613.1.71028 XP_018894399.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]