SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|10190712|ref|NP_065723.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10190712|ref|NP_065723.1|
Domain Number 1 Region: 16-90
Classification Level Classification E-value
Superfamily EF-hand 0.000000000079
Family SCOPe 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|10190712|ref|NP_065723.1|
Sequence length 104
Comment protein S100-A14 [Homo sapiens]
Sequence
MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPS
NCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Download sequence
Identical sequences Q9HCY8
ENSP00000340463 ENSP00000357690 ENSP00000357691 ENSP00000420296 gi|10190712|ref|NP_065723.1| NP_065723.1.87134 NP_065723.1.92137 XP_005245419.1.92137 XP_016857364.1.92137 GO.33767 2m0r_A 2m0r_B 000222189|e2m0rA1|108.1.1.28|A:1-104 000990973|e2m0rB1|108.1.1.28|B:1-104 d2m0ra_ d2m0rb_ 9606.ENSP00000340463 ENSP00000340463 ENSP00000340463 ENSP00000357690 ENSP00000357691 ENSP00000420296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]