SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|10346135|ref|NP_055083.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10346135|ref|NP_055083.1|
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 243-303
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 2.09e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|10346135|ref|NP_055083.1|
Sequence length 327
Comment microtubule-associated protein RP/EB family member 2 isoform 1 [Homo sapiens]
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSR
HDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIP
PPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDL
ETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYAS
EEHEGHTEEPEAEEQAHEQQPPQQEEY
Download sequence
Identical sequences A0A024RC33 Q15555
NP_055083.1.87134 NP_055083.1.92137 gi|10346135|ref|NP_055083.1| ENSP00000300249 9606.ENSP00000300249 ENSP00000300249 ENSP00000300249 Q15555 hsi002005850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]