SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|10864037|ref|NP_067046.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|10864037|ref|NP_067046.1|
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily EF-hand 1.46e-33
Family Calmodulin-like 0.0000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|10864037|ref|NP_067046.1|
Sequence length 175
Comment myosin regulatory light chain 2, atrial isoform [Homo sapiens]
Sequence
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
Download sequence
Identical sequences G1QU13 G3QQE6 H2QUI2 Q01449
9598.ENSPTRP00000032689 9606.ENSP00000223364 ENSNLEP00000004433 NP_067046.1.87134 NP_067046.1.92137 XP_003268907.1.23891 XP_004045423.1.27298 XP_519549.2.37143 ENSP00000223364 ENSP00000223364 gi|10864037|ref|NP_067046.1| ENSPTRP00000032689 ENSNLEP00000004433 ENSPTRP00000032689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]