SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|108773799|ref|NP_001035808.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|108773799|ref|NP_001035808.1|
Domain Number 1 Region: 134-232
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.76e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 2-33
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000215
Family Glutathione S-transferase (GST), N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|108773799|ref|NP_001035808.1|
Sequence length 290
Comment ganglioside-induced differentiation-associated protein 1 isoform b [Homo sapiens]
Sequence
MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELL
DSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAK
QKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLAD
VSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTA
FRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Download sequence
Identical sequences A0A2J8M9U2 A0A2J8VA11
gi|108773799|ref|NP_001035808.1| ENSP00000417006 ENSP00000417006 NP_001035808.1.87134 NP_001035808.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]