SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|109138565|ref|NP_001035851.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109138565|ref|NP_001035851.1|
Domain Number 1 Region: 4-225
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.41e-84
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|109138565|ref|NP_001035851.1|
Sequence length 228
Comment tyrosine-protein phosphatase non-receptor type 20 isoform 5 [Homo sapiens]
Sequence
MIDDSTRVPLGKSKDYINASYIRIVNCGEEYFYIATQGPLLSTIDDFWQMVLENNSNVIA
MITREIEGGIIKCYHYWPISLKKPLELKHFRVFLENYQILQYFIIRMFQVVEKSTGTSHS
VKQLQFTKWPDHGTPASADSFIKYIRYARKSHLTGPMVVHCSAGIGRTGVFLCVDVVFCA
IVKNCSFNIMDIVAQMREQRSGMVQTKEQYHFCYDIVLEVLRKLLTLD
Download sequence
Identical sequences A0A2I3RHX3
NP_001035819.1.87134 NP_001035819.1.92137 gi|108802611|ref|NP_001035819.1| gi|109138565|ref|NP_001035851.1| ENSP00000379033 ENSP00000379077 ENSP00000463290 ENSP00000379077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]