SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109150416|ref|NP_036425.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109150416|ref|NP_036425.1|
Domain Number 1 Region: 735-1314
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.18e-203
Family Myeloperoxidase-like 0.000000000544
Further Details:      
 
Domain Number 2 Region: 62-249
Classification Level Classification E-value
Superfamily L domain-like 5.78e-43
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 3 Region: 342-436
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-25
Family I set domains 0.0095
Further Details:      
 
Domain Number 4 Region: 426-521
Classification Level Classification E-value
Superfamily Immunoglobulin 9.17e-25
Family I set domains 0.0077
Further Details:      
 
Domain Number 5 Region: 527-615
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-24
Family I set domains 0.036
Further Details:      
 
Domain Number 6 Region: 245-339
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 7 Region: 1414-1472
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000167
Family VWC domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|109150416|ref|NP_036425.1|
Sequence length 1479
Comment peroxidasin homolog precursor [Homo sapiens]
Sequence
MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAV
APQTSILDLRFNRIREIQPGAFRRLRNLNTLLLNNNQIKRIPSGAFEDLENLKYLYLYKN
EIQSIDRQAFKGLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHLVPGTFNH
LESMKRLRLDSNTLHCDCEILWLADLLKTYAESGNAQAAAICEYPRRIQGRSVATITPEE
LNCERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWLRNNNELSMKTDSRLNLLDDG
TLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVT
LECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDS
VHATAFIIVQALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHL
VLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGA
NVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTI
GSASVSMVLSVNVPDVSRNGDPFVATSIVEAIATVDRAINSTRTHLFDSRPRSPNDLLAL
FRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNGTSYHYNDLVSPQYLNLIANL
SGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRG
INPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAR
FSDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPR
EQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECM
RDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRK
IVGAEIQHITYQHWLPKILGEVGMRTLGEYHGYDPGINAGIFNAFATAAFRFGHTLVNPL
LYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRGLFGVAGKMRVPSQLLNTELT
ERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKNEIKNPEIREK
LKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA
QLTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCEDCR
TRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDAS
GTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECK
DGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP
Download sequence
Identical sequences Q92626
9606.ENSP00000252804 ENSP00000252804 ENSP00000252804 NP_036425.1.87134 NP_036425.1.92137 NYSGRC-IgSF-PXDN_HUMAN gi|109150416|ref|NP_036425.1| ENSP00000252804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]