SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109240556|ref|NP_060457.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109240556|ref|NP_060457.4|
Domain Number 1 Region: 44-208
Classification Level Classification E-value
Superfamily RUN domain-like 1.7e-48
Family RUN domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 571-637
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|109240556|ref|NP_060457.4|
Sequence length 641
Comment RUN and FYVE domain-containing protein 2 isoform a [Homo sapiens]
Sequence
MTFQVWGWRREDASQVLAWVPDAEGGRRGMLTRRSLATKDPTAVERANLLNMAKLSIKGL
IESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRKSFLSYNKTIWGPLELVEKLYPEA
EEIGASVRDLPGLKTPLGRARAWLRLALMQKKMADYLRCLIIQRDLLSEFYEYHALMMEE
EGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNEEDIGNKERNVQIAAILDQ
KNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRSENKLI
LMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNEARRQLRDESQLRQDVENELAVQVSM
KHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIARL
EEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQL
ETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQIISLKKEFLNLQDENQQLKKIYHEQE
QALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEATHCKLCEKEFSLSKRKHHCRNC
GEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQRCSSNLP
Download sequence
Identical sequences G3QD14 H2Q1Z4
gi|109240556|ref|NP_060457.4| ENSPTRP00000004415 ENSP00000373420 ENSGGOP00000000117 NP_060457.4.87134 NP_060457.4.92137 XP_003830345.1.60992 XP_004049543.1.27298 XP_009456835.1.37143 9598.ENSPTRP00000004415 9606.ENSP00000373420 ENSPTRP00000004415 ENSP00000373420 ENSP00000373420 ENSGGOP00000000117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]