SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|109809759|ref|NP_821079.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|109809759|ref|NP_821079.3|
Domain Number 1 Region: 34-329
Classification Level Classification E-value
Superfamily L domain-like 1.02e-55
Family Ngr ectodomain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|109809759|ref|NP_821079.3|
Sequence length 581
Comment leucine-rich repeat transmembrane neuronal protein 3 precursor [Homo sapiens]
Sequence
MGFNVIRLLSGSAVALVIAPTVLLTMLSSAERGCPKGCRCEGKMVYCESQKLQEIPSSIS
AGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNIDENAFNGIRRLKELILSSNR
ISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKLLSLHLRSNSLRTIPVRIFQDC
RNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFSKLNLALFPRLVSLQNLYLQWNK
ISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCVPNLQRLNLDSNKLTFIGQEILDS
WISLNDISLAGNIWECSRNICSLVNWLKSFKGLRENTIICASPKELQGVNVIDAVKNYSI
CGKSTTERFDLARALPKPTFKPKLPRPKHESKPPLPPTVGATEPGPETDADAEHISFHKI
IAGSVALFLSVLVILLVIYVSWKRYPASMKQLQQRSLMRRHRKKKRQSLKQMTPSTQEFY
VDYKPTNTETSEMLLNGTGPCTYNKSGSRECEIPLSMNVSTFLAYDQPTISYCGVHHELL
SHKSFETNAQEDTMETHLETELDLSTITTAGRISDHKQQLA
Download sequence
Identical sequences A0A096P543 A0A1D5QPH9 A0A287BRY8 A0A2K5J6S2 A0A2K5NT54 A0A2K6DT31 G1RN09 G3SCU0 H2Q1Y8 Q86VH5 Q9BGP6
ENSMMUP00000024694 ENSP00000355187 gi|109809759|ref|NP_821079.3| ENSP00000355187 ENSNLEP00000014623 ENSNLEP00000014623 NP_001253504.1.72884 NP_821079.3.87134 NP_821079.3.92137 XP_001924493.1.46622 XP_003258268.1.23891 XP_003312627.1.37143 XP_007961490.1.81039 XP_011713421.1.29376 XP_011781311.1.43180 XP_011940576.1.92194 XP_015311390.1.63531 XP_018890896.1.27298 ENSMMUP00000024694 ENSPTRP00000004388 ENSP00000355187 ENSPTRP00000004388 9544.ENSMMUP00000024694 9606.ENSP00000355187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]