SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110225353|ref|NP_001035987.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110225353|ref|NP_001035987.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-34
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110225353|ref|NP_001035987.1|
Sequence length 410
Comment sprouty-related, EVH1 domain-containing protein 3 isoform a [Homo sapiens]
Sequence
MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKT
TLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTP
SSSSSSSSPSQDTAETPCPLTSHVDSDSSSSHSRQETPPSAAAAPIITMESASGFGPTTP
PQRRRSSAQSYPPLLPFTGIPEPSEPLAGAGGLGWGGRGYEDYRRSGPPAPLALSTCVVR
FAKTGALRGAALGPPAALPAPLTEAAPPAPPARPPPGPGPSSAPAKASPEAEEAARCVHC
RALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSDPCACEPGH
PRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAAR
Download sequence
Identical sequences Q2MJR0
gi|110225353|ref|NP_001035987.1| 9606.ENSP00000345405 NP_001035987.1.87134 NP_001035987.1.92137 XP_006723282.1.92137 ENSP00000345405 ENSP00000466568 ENSP00000345405 ENSP00000466568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]