SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110227594|ref|NP_219501.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110227594|ref|NP_219501.2|
Domain Number 1 Region: 41-189
Classification Level Classification E-value
Superfamily EF-hand 9.22e-38
Family Calmodulin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|110227594|ref|NP_219501.2|
Sequence length 196
Comment calmodulin-like protein 4 isoform 1 [Homo sapiens]
Sequence
MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECF
SLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQI
KQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKV
KYDEFIHKITLPGRDY
Download sequence
Identical sequences Q96GE6
ENSP00000400755 NP_219501.2.87134 NP_219501.2.92137 ENSP00000419081 9606.ENSP00000419081 gi|110227594|ref|NP_219501.2| ENSP00000419081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]