SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110227596|ref|NP_001026903.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110227596|ref|NP_001026903.2|
Domain Number 1 Region: 45-142
Classification Level Classification E-value
Superfamily EF-hand 5.35e-22
Family Calmodulin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110227596|ref|NP_001026903.2|
Sequence length 149
Comment calmodulin-like protein 4 isoform 2 [Homo sapiens]
Sequence
MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINDGNGEL
DFSTFLTIMHMQIKQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDD
LFREADIEPNGKVKYDEFIHKITLPGRDY
Download sequence
Identical sequences NP_001026903.2.87134 NP_001026903.2.92137 gi|110227596|ref|NP_001026903.2| ENSP00000400755 ENSP00000400755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]