SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110227613|ref|NP_114152.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110227613|ref|NP_114152.3|
Domain Number 1 Region: 666-777
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.62e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.0004
Further Details:      
 
Domain Number 2 Region: 124-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-33
Family G proteins 0.00000192
Further Details:      
 
Domain Number 3 Region: 392-466,605-650
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 4 Region: 789-879
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000637
Family Ankyrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110227613|ref|NP_114152.3|
Sequence length 911
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 isoform a [Homo sapiens]
Sequence
MNFQAGGGQSPQQQQSLAAPGGGGAAAQQLVCGGQFGGAGPGAGGGGGPSQQLAGGPPQQ
FALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWT
LSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRD
EGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISA
ANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCK
SLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASST
PTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNK
EWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTSP
RANGLSVERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPEGLHQRSCSVSSADQ
WSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGPSSAT
EEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQN
AALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD
DWPPELLAVMTAMGNALANSVWEGALGGYSKPGPDACREEKERWIRAKYEQKLFLAPLPS
SDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQL
LIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNP
SAELHRSPSLL
Download sequence
Identical sequences ENSP00000380413 gi|110227613|ref|NP_114152.3| NP_114152.3.87134 NP_114152.3.92137 ENSP00000380413 ENSP00000380413 9606.ENSP00000380413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]