SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110347408|ref|NP_006645.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110347408|ref|NP_006645.3|
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-41
Family Phosphotyrosine-binding domain (PTB) 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110347408|ref|NP_006645.3|
Sequence length 508
Comment fibroblast growth factor receptor substrate 2 [Homo sapiens]
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHVPLEARVSNAESSTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPS
VNKLVYENINGLSIPSASGVRRGRLTSTSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences L7RTG7 Q8WU20
gi|110347408|ref|NP_006645.3| gi|110347414|ref|NP_001036020.1| ENSP00000381083 ENSP00000447241 ENSP00000450048 NP_001036020.1.87134 NP_001036020.1.92137 NP_001265280.1.87134 NP_001265280.1.92137 NP_001265282.1.87134 NP_001265282.1.92137 NP_001265283.1.87134 NP_001265283.1.92137 NP_001265284.1.87134 NP_001265284.1.92137 NP_001265285.1.87134 NP_001265285.1.92137 NP_001265286.1.87134 NP_001265286.1.92137 NP_006645.3.87134 NP_006645.3.92137 XP_016874206.1.92137 XP_016874207.1.92137 XP_016874208.1.92137 ENSP00000299293 ENSP00000299293 ENSP00000381083 ENSP00000447241 ENSP00000450048 9606.ENSP00000299293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]