SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110347412|ref|NP_003564.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110347412|ref|NP_003564.2|
Domain Number 1 Region: 365-432
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-19
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 510-638
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 1143-1205
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.62e-17
Family TB module/8-cys domain 0.00019
Further Details:      
 
Domain Number 4 Region: 633-761
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.1e-16
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 5 Region: 1307-1370
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 6 Region: 844-968
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000604
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 764-887
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000738
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 1499-1582
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000455
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 318-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000547
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 10 Region: 249-315
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000549
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 11 Region: 1010-1065
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.026
Further Details:      
 
Domain Number 12 Region: 1250-1300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.011
Further Details:      
 
Domain Number 13 Region: 1215-1264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000331
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 119-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000373
Family EGF-type module 0.033
Further Details:      
 
Domain Number 15 Region: 976-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000664
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|110347412|ref|NP_003564.2|
Domain Number - Region: 1057-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00724
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110347412|ref|NP_003564.2|
Sequence length 1587
Comment latent-transforming growth factor beta-binding protein 4 isoform b [Homo sapiens]
Sequence
MGDVKALLFVAAARARRLGGAAASESLAVSEAFCRVRSCQPKKCAGPQRCLNPVPAVPSP
SPSVRKRQVSLNWQPLTLQEARALLKRRRPRGPGGRGLLRRRPPQRAPAGKAPVLCPLIC
HNGGVCVKPDRCLCPPDFAGKFCQLHSSGARPPAPAVPGLTRSVYTMPLANHRDDEHGVA
SMVSVHVEHPQEASVVVHQVERVSGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPRE
DGYSDASGFGYCFRELRGGECASPLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERV
SAPDGPCPTGFERVNGSCEDVDECATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCI
SQHVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFRE
ICPAGPGYHYSASDLRYNTRPLGQEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPR
PDPRPGPELPLPSIPAWTGPEIPESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFR
LSPQGTRCIDVDECRRVPPPCAPGRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVP
PPCDLGRCENTPGSFLCVCPAGYQAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCV
CPAGFRGSACEEDVDECAQEPPPCGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECA
RSPPPCTYGRCENTEGSFQCVCPMGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQ
CRTCPSGHHLHRGRCTDVDECSSGAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCA
DVNECLEGDFCFPHGECLNTDGSFACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTN
TDGSFECICPPGHRAGPDLASCLDVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHA
GPEGTCDDVDECQEYGPEICGAQRCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRS
FCGAHAVCQNLPGSFQCLCDQGYEGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCV
CPNSPEEFDPMTGRCVPPRTSAGTFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVG
SGRRECYFDTAAPDACDNILARNVTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPH
GRGYLAPSGDLSLRRDVDECQLFRDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDN
DECADEEPACEGGRCVNTVGSYHCTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGA
DLVCSHPRLDRQATYTECCCLYGEAWGMDCALCPAQDSDDFEALCNVLRPPAYSPPRPGG
FGLPYEYGPDLGPPYQGLPYGPELYPPPALPYDPYPPPPGPFARREAPYGAPRFDMPDFE
DDGGPYGESEAPAPPGPGTRWPYRSRDTRRSFPEPEEPPEGGSYAGSLAEPYEELEAEEC
GILDGCTNGRCVRVPEGFTCRCFDGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTD
GSFRCICRPGFAPTHQPHHCAPARPRA
Download sequence
Identical sequences A0A0C4DH07
ENSP00000204005 gi|110347412|ref|NP_003564.2| NP_003564.2.87134 NP_003564.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]