SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110611156|ref|NP_006050.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110611156|ref|NP_006050.3|
Domain Number 1 Region: 810-863
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000363
Family Laminin-type module 0.00036
Further Details:      
 
Domain Number 2 Region: 271-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 866-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.00096
Further Details:      
 
Domain Number 4 Region: 917-958
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 5 Region: 707-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 6 Region: 430-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 7 Region: 383-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 327-385
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 9 Region: 755-812
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family Laminin-type module 0.0005
Further Details:      
 
Domain Number 10 Region: 965-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  gi|110611156|ref|NP_006050.3|
Domain Number - Region: 85-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00102
Family CBM4/9 0.085
Further Details:      
 
Domain Number - Region: 669-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110611156|ref|NP_006050.3|
Sequence length 1575
Comment laminin subunit gamma-3 precursor [Homo sapiens]
Sequence
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAHCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKVCASTAQFQVHHILSDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPVQLRLEGTGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLRVSPGPSPAGPVFLTEVRLTSAR
PGLSPPASWVEICSCPTGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESREVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQQCPSCYALV
KEEAAKLKARLTLTEGWLQGSDCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLEQM
MSLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLE
IPQEGPSQPTKWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAQKALRTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQATLRQTEPLTKLHQEARAALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRKKTKQA
ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQQA
SQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL
EAILHSLPENCASWQ
Download sequence
Identical sequences Q9Y6N6
gi|110611156|ref|NP_006050.3| ENSP00000354360 9606.ENSP00000354360 ENSP00000354360 NP_006050.3.87134 NP_006050.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]