SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110611178|ref|NP_057450.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110611178|ref|NP_057450.2|
Domain Number 1 Region: 73-218
Classification Level Classification E-value
Superfamily EF-hand 2.38e-40
Family Calmodulin-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110611178|ref|NP_057450.2|
Sequence length 220
Comment calcium-binding protein 2 [Homo sapiens]
Sequence
MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACI
FLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELI
EISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAA
LKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR
Download sequence
Identical sequences Q9NPB3
gi|110611178|ref|NP_057450.2| NP_057450.2.87134 NP_057450.2.92137 ENSP00000294288 9606.ENSP00000294288 ENSP00000294288 ENSP00000294288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]