SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110624794|ref|NP_060894.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110624794|ref|NP_060894.2|
Domain Number 1 Region: 270-402
Classification Level Classification E-value
Superfamily PH domain-like 9.53e-39
Family Third domain of FERM 0.00053
Further Details:      
 
Domain Number 2 Region: 168-272
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 86-165
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.45e-25
Family First domain of FERM 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|110624794|ref|NP_060894.2|
Sequence length 518
Comment band 4.1-like protein 4B isoform 1 [Homo sapiens]
Sequence
MLRFLRRTFGRRSMQRYARGAAGRGAAGLGDERDGGPRGGPAAAASSSALPAAPGGSVFP
AGGGPLLTGGAAVHISAAGAAKATLYCRVFLLDGTEVSVDLPKHAKGQDLFDQIVYHLDL
VETDYFGLQFLDSAQVAHWLDHAKPIKKQMKIGPAYALHFRVKYYSSEPNNLREEFTRYL
FVLQLRHDILSGKLKCPYETAVELAALCLQAELGECELPEHTPELVSEFRFIPNQTEAME
FDIFQRWKECRGKSPAQAELSYLNKAKWLEMYGVDMHVVRGRDGCEYSLGLTPTGILIFE
GANKIGLFFWPKITKMDFKKSKLTLVVVEDDDQGREQEHTFVFRLDSARTCKHLWKCAVE
HHAFFRLRTPGNSKSNRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSR
RHSTFKASNPVIAAQLCSKTNPEVHNYQPQYHPNIHPSQPRWHPHSPNVRPSFQDDRSHW
KASASGDDSHFDYVHDQNQKNLGGMQSMMYRDKLMTAL
Download sequence
Identical sequences A0A2I3T1T4
ENSP00000363685 ENSP00000363685 NP_060894.2.87134 NP_060894.2.92137 XP_016816897.1.37143 gi|110624794|ref|NP_060894.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]