SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|110835717|ref|NP_653248.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|110835717|ref|NP_653248.3|
Domain Number 1 Region: 41-206
Classification Level Classification E-value
Superfamily EF-hand 2.64e-36
Family Calmodulin-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|110835717|ref|NP_653248.3|
Sequence length 208
Comment calcyphosin-like protein [Homo sapiens]
Sequence
MAGTARHDREMAIQAKKKLTTATDPIERLRLQCLARGSAGIKGLGRVFRIMDDDNNRTLD
FKEFMKGLNDYAVVMEKEEVEELFRRFDKDGNGTIDFNEFLLTLRPPMSRARKEVIMQAF
RKLDKTGDGVITIEDLREVYNAKHHPKYQNGEWSEEQVFRKFLDNFDSPYDKDGLVTPEE
FMNYYAGVSASIDTDVYFIIMMRTAWKL
Download sequence
Identical sequences Q8WWF8
ENSP00000380523 ENSP00000380523 ENSP00000380524 9606.ENSP00000380523 ENSP00000380523 ENSP00000380524 gi|110835715|ref|NP_001036090.1| gi|110835717|ref|NP_653248.3| NP_001036090.1.87134 NP_001036090.1.92137 NP_653248.3.87134 NP_653248.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]