SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111125011|ref|NP_009122.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|111125011|ref|NP_009122.2|
Domain Number - Region: 214-244
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 277-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 245-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000255
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 181-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00143
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 310-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0059
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111125011|ref|NP_009122.2|
Sequence length 379
Comment wnt inhibitory factor 1 precursor [Homo sapiens]
Sequence
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
Download sequence
Identical sequences Q9Y5W5
gi|111125011|ref|NP_009122.2| 9606.ENSP00000286574 NP_009122.2.87134 NP_009122.2.92137 ENSP00000286574 ENSP00000286574 ENSP00000286574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]