SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|112420992|ref|NP_775960.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|112420992|ref|NP_775960.4|
Domain Number 1 Region: 414-598
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.21e-17
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 2 Region: 621-816
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.51e-16
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 3 Region: 830-1029
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000192
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 4 Region: 108-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 320-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000407
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 6 Region: 146-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 7 Region: 358-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000219
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 224-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 9 Region: 184-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000317
Family EGF-type module 0.006
Further Details:      
 
Domain Number 10 Region: 1059-1099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 11 Region: 1175-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000757
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 74-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000973
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1094-1132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000409
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 262-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000542
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  gi|112420992|ref|NP_775960.4|
Domain Number - Region: 1137-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0224
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|112420992|ref|NP_775960.4|
Sequence length 1285
Comment crumbs homolog 2 precursor [Homo sapiens]
Sequence
MALARPGTPDPQALASVLLLLLWAPALSLLAGTVPSEPPSACASDPCAPGTECQATESGG
YTCGPMEPRGCATQPCHHGALCVPQGPDPTGFRCYCVPGFQGPRCELDIDECASRPCHHG
ATCRNLADRYECHCPLGYAGVTCEMEVDECASAPCLHGGSCLDGVGSFRCVCAPGYGGTR
CQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTHCEREVLECASAPCEHNASCLE
GLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDPALYGGVQAAFPGAFSFRH
AAGFLCHCPPGFEGADCGVEVDECASRPCLNGGHCQDLPNGFQCHCPDGYAGPTCEEDVD
ECLSDPCLHGGTCSDTVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCIPIFESGVH
SYVCHCPPGTHGPFCGQNTTFSVMAGSPIQASVPAGGPLGLALRFRTTLPAGTLATRNDT
KESLELALVAATLQATLWSYSTTVLVLRLPDLALNDGHWHQVEVVLHLATLELRLWHEGC
PARLCVASGPVALASTASATPLPAGISSAQLGDATFAGCLQDVRVDGHLLLPEDLGENVL
LGCERREQCRPLPCVHGGSCVDLWTHFRCDCARPHRGPTCADEIPAATFGLGGAPSSASF
LLQELPGPNLTVSFLLRTRESAGLLLQFANDSAAGLTVFLSEGRIRAEVPGSPAVVLPGR
WDDGLRHLVMLSFGPDQLQDLGQHVHVGGRLLAADSQPWGGPFRGCLQDLRLDGCHLPFF
PLPLDNSSQPSELGGRQSWNLTAGCVSEDMCSPDPCFNGGTCLVTWNDFHCTCPANFTGP
TCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFREGPPAAFSGHNASSGRLLGGLSLAF
RTRDSEAWLLRAAAGALEGVWLAVRNGSLAGGVRGGHGLPGAVLPIPGPRVADGAWHRVR
LAMERPAATTSRWLLWLDGAATPVALRGLASDLGFLQGPGAVRILLAENFTGCLGRVALG
GLPLPLARPRPGAAPGAREHFASWPGTPAPILGCRGAPVCAPSPCLHDGACRDLFDAFAC
ACGPGWEGPRCEAHVDPCHSAPCARGRCHTHPDGRFECRCPPGFGGPRCRLPVPSKECSL
NVTCLDGSPCEGGSPAANCSCLEGLAGQRCQVPTLPCEANPCLNGGTCRAAGGVSECICN
ARFSGQFCEVAKGLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSP
SQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences Q5IJ48
9606.ENSP00000362734 NP_775960.4.87134 NP_775960.4.92137 ENSP00000362734 gi|112420992|ref|NP_775960.4| ENSP00000362734 ENSP00000362732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]