SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11276069|ref|NP_068707.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11276069|ref|NP_068707.1|
Domain Number 1 Region: 21-142
Classification Level Classification E-value
Superfamily EF-hand 3.01e-38
Family EF-hand modules in multidomain proteins 0.0057
Further Details:      
 
Domain Number 2 Region: 144-236
Classification Level Classification E-value
Superfamily EF-hand 1.11e-31
Family EF-hand modules in multidomain proteins 0.0025
Further Details:      
 
Domain Number 3 Region: 219-300
Classification Level Classification E-value
Superfamily RING/U-box 9.54e-20
Family ZZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11276069|ref|NP_068707.1|
Sequence length 627
Comment dystrobrevin beta isoform 1 [Homo sapiens]
Sequence
MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIE
AFRDNGLNTLDHTTEISVSRLETVISSIYYQLNKRLPSTHQISVEQSISLLLNFMIAAYD
SEGRGKLTVFSVKAMLATMCGGKMLDKLRYVFSQMSDSNGLMIFSKFDQFLKEVLKLPTA
VFEGPSFGYTEHSVRTCFPQQRKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHP
VECSYCRCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKEHSSWKSPAKKLS
HAISKSLGCVPTREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKR
LQYSQDIPSHLADEHALIASYVARLQHCARVLDSPSRLDEEHRLIARYAARLAAEAGNVT
RPPTDLSFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLA
ELRLLRQRKDELEQRMSALQESRRELMVQLEELMKLLKEEEQKQAAQATGSPHTSPTHGG
GRPMPMPVRSTSAGSTPTHCPQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMS
SLVKELHSAEEGAEEEEEKMQNGKDRG
Download sequence
Identical sequences O60941
NP_068707.1.87134 NP_068707.1.92137 9606.ENSP00000384084 gi|11276069|ref|NP_068707.1| ENSP00000384084 ENSP00000384084 ENSP00000288642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]