SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11321571|ref|NP_003053.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11321571|ref|NP_003053.1|
Domain Number 1 Region: 34-217,296-464
Classification Level Classification E-value
Superfamily L domain-like 2.77e-62
Family Ngr ectodomain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 508-674,754-868
Classification Level Classification E-value
Superfamily L domain-like 5.95e-50
Family Ngr ectodomain-like 0.0000313
Further Details:      
 
Domain Number 3 Region: 1142-1332
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.87e-39
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 999-1111
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000361
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 955-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000151
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 912-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000648
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 7 Region: 1416-1444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000159
Family EGF-type module 0.021
Further Details:      
 
Domain Number 8 Region: 1369-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000795
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  gi|11321571|ref|NP_003053.1|
Domain Number - Region: 1335-1366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00198
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11321571|ref|NP_003053.1|
Sequence length 1523
Comment slit homolog 3 protein precursor [Homo sapiens]
Sequence
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRGITDVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTVGQFT
LCMAPVHLRGFNVADVQKKEYVCPAPHSEPPSCNANSISCPSPCTCSNNIVDCRGKGLME
IPANLPEGIVEIRLEQNSIKAIPAGAFTQYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIPSHLPEYVTDLRLN
DNEVSVLEATGIFKKLPNLRKINLSNNKIKEVREGAFDGAASVQELMLTGNQLETVHGRV
FRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCDGNEESSCQ
LSPRCPEQCTCMETVVRCSNKGLRALPRGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
DLSNNSISMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPEPMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCTQDPVELYRCACPYSYKGKDCTVPINTCI
QNPCQHGGTCHLSDSHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
ICPPNYTGELCDEVIDHCVPELNLCQHEAKCIPLDKGFSCECVPGYSGKLCETDNDDCVA
HKCRHGAQCVDTINGYTCTCPQGFSGPFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDSLSSPPTTVYSVETVNDGQFHSVELVTLNQTLNLVVDKGTPK
SLGKLQKQPAVGINSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECRPGWTGPLCDQEARDPCLGHRCHHG
KCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSG
EHCQQENPCLGQVVREVIRRQKGYASCATASKVPIMECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCLACS
Download sequence
Identical sequences NP_003053.1.87134 NP_003053.1.92137 gi|11321571|ref|NP_003053.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]