SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11496971|ref|NP_000823.4| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11496971|ref|NP_000823.4|
Domain Number 1 Region: 21-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.19e-60
Family L-arabinose binding protein-like 0.0034
Further Details:      
 
Domain Number 2 Region: 397-544,661-799
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.96e-55
Family Phosphate binding protein-like 0.0000000000964
Further Details:      
 
Domain Number 3 Region: 551-656,690-718
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000126
Family Voltage-gated potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11496971|ref|NP_000823.4|
Sequence length 885
Comment glutamate [NMDA] receptor subunit zeta-1 isoform NR1-1 precursor [Homo sapiens]
Sequence
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEAKELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTLSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQQYHPTDITGPLNLSDPSVSTVV
Download sequence
Identical sequences A0A2J8N9L5 A0A2J8RMI9 A0A2K6BVF5 A0A2K6MT64 H9EPG1
gi|11496971|ref|NP_000823.4| NP_000823.4.87134 NP_000823.4.92137 XP_005580401.1.63531 XP_008003707.1.81039 XP_011723175.1.29376 XP_011904253.1.92194 XP_014971758.1.72884 NYSGRC-11496971 ENSP00000360614 ENSP00000360614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]