SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115298657|ref|NP_002954.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115298657|ref|NP_002954.2|
Domain Number 1 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 9.41e-24
Family S100 proteins 0.00000895
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115298657|ref|NP_002954.2|
Sequence length 101
Comment protein S100-A7 [Homo sapiens]
Sequence
MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFE
KKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Download sequence
Identical sequences P31151
ENSP00000357711 ENSP00000357712 gi|115298657|ref|NP_002954.2| 9606.ENSP00000357711 ENSP00000357711 NP_002954.2.87134 NP_002954.2.92137 ENSP00000357711 ENSP00000357712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]