SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115298659|ref|NP_003117.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115298659|ref|NP_003117.2|
Domain Number 1 Region: 424-579
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-33
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 2 Region: 636-789
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-32
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 318-468
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-31
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 4 Region: 217-367
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-31
Family Spectrin repeat 0.00051
Further Details:      
 
Domain Number 5 Region: 1449-1603
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-29
Family Spectrin repeat 0.00019
Further Details:      
 
Domain Number 6 Region: 756-896
Classification Level Classification E-value
Superfamily Spectrin repeat 1.32e-28
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 7 Region: 1713-1819
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-27
Family Spectrin repeat 0.00000822
Further Details:      
 
Domain Number 8 Region: 1343-1496
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-27
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 9 Region: 124-261
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-26
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 10 Region: 1237-1380
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 1767-1926
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-26
Family Spectrin repeat 0.0000926
Further Details:      
 
Domain Number 12 Region: 19-154
Classification Level Classification E-value
Superfamily Spectrin repeat 6.7e-25
Family Spectrin repeat 0.000000126
Further Details:      
 
Domain Number 13 Region: 2038-2150
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-24
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 14 Region: 1575-1695
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-23
Family Spectrin repeat 0.0000665
Further Details:      
 
Domain Number 15 Region: 977-1058
Classification Level Classification E-value
Superfamily SH3-domain 1.29e-19
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 16 Region: 900-964,1042-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 1.35e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 17 Region: 1895-2031
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-17
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 18 Region: 2157-2264
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 19 Region: 2266-2416
Classification Level Classification E-value
Superfamily EF-hand 3.31e-16
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 20 Region: 1088-1182
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000327
Family Spectrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|115298659|ref|NP_003117.2|
Sequence length 2419
Comment spectrin alpha chain, erythrocyte [Homo sapiens]
Sequence
MEQFPKETVVESSGPKVLETAEEIQERRQEVLTRYQSFKERVAERGQKLEDSYHLQVFKR
DADDLGKWIMEKVNILTDKSYEDPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFT
MGHSAHEETKAHIEELRHLWDLLLELTLEKGDQLLRALKFQQYVQECADILEWIGDKEAI
ATSVELGEDWERTEVLHKKFEDFQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQN
EVNAAWERLRGLALQRQKALSNAANLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASE
GLFHSHKGLERNLAVMSDKVKELCAKAEKLTLSHPSDAPQIQEMKEDLVSSWEHIRALAT
SRYEKLQATYWYHRFSSDFDELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEID
SYDDRFQSADETGQDLVNANHEASDEVREKMEILDNNWTALLELWDERHRQYEQCLDFHL
FYRDSEQVDSWMSRQEAFLENEDLGNSLGSAEALLQKHEDFEEAFTAQEEKIITVDKTAT
KLIGDDHYDSENIKAIRDGLLARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINK
KKKLADDEDYKDIQNLKSRVQKQQVFEKELAVNKTQLENIQKTGQEMIEGGHYASDNVTT
RLSEVASLWEELLEATKQKGTQLHEANQQLQFENNAEDLQRWLEDVEWQVTSEDYGKGLA
EVQNRLRKHGLLESAVAARQDQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKE
PLATRKKKLLDLLHLQLICRDTEDEEAWIQETEPSATSTYLGKDLIASKKLLNRHRVILE
NIASHEPRIQEITERGNKMVEEGHFAAEDVASRVKSLNQNMESLRARAARRQNDLEANVQ
FQQYLADLHEAETWIREKEPIVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALRN
QANACQQQQAAPVEGVAGEQRVMALYDFQARSPREVTMKKGDVLTLLSSINKDWWKVEAA
DHQGIVPAVYVRRLAHDEFPMLPQRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQ
RYNEFLLAYEAGDMLEWIQEKKAENTGVELDDVWELQKKFDEFQKDLNTNEPRLRDINKV
ADDLLFEGLLTPEGAQIRQELNSRWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIE
KKCQALSAADPGSDLFSVQALQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDL
QRQKMELNEAWEDLQGRTKDRKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAED
LTGIEILLERHQEHRADMEAEAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDL
EKAWEKRKKILDQCLELQMFQGNCDQVESWMVARENSLRSDDKSSLDSLEALMKKRDDLD
KAITAQEGKITDLEHFAESLIADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYA
NLKQFYRDLEELEEWISEMLPTACDESYKDATNIQRKYLKHQTFAHEVDGRSEQVHGVIN
LGNSLIECSACDGNEEAMKEQLEQLKEHWDHLLERTNDKGKKLNEASRQQRFNTSIRDFE
FWLSEAETLLAMKDQARDLASAGNLLKKHQLLEREMLAREDALKDLNTLAEDLLSSGTFN
VDQIVKKKDNVNKRFLNVQELAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQD
YGRDLQGVQNLLKKHKRLEGELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEH
WEKLKELAKARGLKLEESLEYLQFMQNAEEEEAWINEKNALAVRGDCGDTLAATQSLLMK
HEALENDFAVHETRVQNVCAQGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAW
KLQLEDDYAFQEFNWKADVVEAWIADKETSLKTNGNGADLGDFLTLLAKQDTLDASLQSF
QQERLPEITDLKDKLISAQHNQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQK
AEDLFVEFAHKASALNNWCEKMEENLSEPVHCVSLNEIRQLQKDHEDFLASLARAQADFK
CLLELDQQIKALGVPSSPYTWLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQ
EFEQNASTFLQWILETRAYFLDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLG
DNLEDALILDIKYSTIGLAQQWDQLYQLGLRMQHNLEQQIQAKDIKGVSEETLKEFSTIY
KHFDENLTGRLTHKEFRSCLRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYT
AFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
RSHLSGYDYVGFTNSYFGN
Download sequence
Identical sequences P02549
ENSP00000357129 ENSP00000357129 9606.ENSP00000357130 gi|115298659|ref|NP_003117.2| NP_003117.2.87134 NP_003117.2.92137 XP_011508218.1.92137 ENSP00000357129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]