SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115430239|ref|NP_079489.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115430239|ref|NP_079489.2|
Domain Number 1 Region: 245-399
Classification Level Classification E-value
Superfamily Spectrin repeat 7.52e-30
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 2 Region: 458-610
Classification Level Classification E-value
Superfamily Spectrin repeat 2.1e-22
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 34-152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000183
Family Spectrin repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|115430239|ref|NP_079489.2|
Sequence length 678
Comment spectrin beta chain, brain 3 isoform sigma5 [Homo sapiens]
Sequence
MLMARDGTREDNHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKK
LGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKKLLHMESQLQDVDPGGDLAT
VNSQLKKLQSMESQVEEWYREVGELQAQTAALPLEPASKELVGERQNAVGERLVRLLEPL
QERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGNGLQAVQQHIKKNQGLRREI
QAHGPRLEEVLERAGALASLRSPEAEAVRRGLEQLQSAWAGLREAAERRQQVLDAAFQVE
QYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQC
RALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVALEQQYWLYQLSRQVSELEHWIA
EKEVVAGSPELGQDFEHVSVLQEKFSEFASETGMAGRERLAAVNQMVDELIECGHTAAAT
MAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTTPP
EPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGW
KELLSACEDARLHVSSTADALRFHSQVRDLLSWMDGIASQIGAADKPRCPSSLLGLPASP
WWPTPATPSPLTAPFSME
Download sequence
Identical sequences NYSGRC-115430239 gi|115430239|ref|NP_079489.2| NP_079489.2.87134 NP_079489.2.92137 ENSP00000375877 ENSP00000375877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]