SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11545873|ref|NP_071420.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11545873|ref|NP_071420.1|
Domain Number 1 Region: 313-431
Classification Level Classification E-value
Superfamily EF-hand 7.13e-32
Family Osteonectin 0.0084
Further Details:      
 
Domain Number 2 Region: 223-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 89-161
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.84e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 43-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11545873|ref|NP_071420.1|
Sequence length 434
Comment SPARC-related modular calcium-binding protein 1 isoform 2 precursor [Homo sapiens]
Sequence
MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDG
RSYESMCEYQRAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGE
DGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSK
PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSEKVYSCDQERQSALEEAQQ
NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKT
TEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
ERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
LKGCLGVSKEGRLV
Download sequence
Identical sequences A0A024R6E0 Q9H4F8
ENSP00000370680 ENSP00000370680 gi|11545873|ref|NP_071420.1| NP_071420.1.87134 NP_071420.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]