SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115527074|ref|NP_003717.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115527074|ref|NP_003717.3|
Domain Number 1 Region: 7-208
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-50
Family Pleckstrin-homology domain (PH domain) 0.00000287
Further Details:      
 
Domain Number 2 Region: 289-352
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000722
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115527074|ref|NP_003717.3|
Sequence length 359
Comment src kinase-associated phosphoprotein 1 isoform 1 [Homo sapiens]
Sequence
MQAAALPEEIRWLLEDAEEFLAEGLRNENLSAVARDHRDHILRGFQQIKARYYWDFQPQG
GDIGQDSSDDNHSGTLGLSLTSDAPFLSDYQDEGMEDIVKGAQELDNVIKQGYLEKKSKD
HSFFGSEWQKRWCVVSRGLFYYYANEKSKQPKGTFLIKGYGVRMAPHLRRDSKKESCFEL
TSQDRRSYEFTATSPAEARDWVDQISFLLKDLSSLTIPYEEDEEEEEKEETYDDIDGFDS
PSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQ
GLWDCHGDQPDELSFQRGDLIRILSKEYNMYGWWVGELNSLVGIVPKEYLTTAFEVEER
Download sequence
Identical sequences Q86WV1
9606.ENSP00000338171 ENSP00000338171 ENSP00000338171 ENSP00000464311 gi|115527074|ref|NP_003717.3| ENSP00000338171 ENSP00000464311 NP_003717.3.87134 NP_003717.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]