SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|115583657|ref|NP_001002034.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|115583657|ref|NP_001002034.2|
Domain Number 1 Region: 14-134
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|115583657|ref|NP_001002034.2|
Sequence length 259
Comment sesquipedalian-2 [Homo sapiens]
Sequence
MKLNERSVAHYALSDSPADHMGFLRTWGGPGTPPTPSGTGRRCWFVLKGNLLFSFESREG
RAPLSLVVLEGCTVELAEAPVPEEFAFAICFDAPGVRPHLLAAEGPAAQEAWVKVLSRAS
FGYMRLVVRELESQLQDARQSLALQRRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSS
PVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQSPVSPETSCFSTLHDWYGQEIVELRQ
CWQKRAQGSHSKCEEQDRP
Download sequence
Identical sequences Q6ICB4
NP_001002034.2.87134 NP_001002034.2.92137 XP_005261430.1.92137 9606.ENSP00000312753 gi|115583657|ref|NP_001002034.2| ENSP00000312753 ENSP00000475303 ENSP00000475542 GO.99746 ENSP00000312753 ENSP00000312753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]