SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116006965|ref|NP_004486.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116006965|ref|NP_004486.2|
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-18
Family I set domains 0.015
Further Details:      
 
Weak hits

Sequence:  gi|116006965|ref|NP_004486.2|
Domain Number - Region: 178-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000377
Family EGF-type module 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116006965|ref|NP_004486.2|
Sequence length 211
Comment pro-neuregulin-1, membrane-bound isoform isoform HRG-gamma [Homo sapiens]
Sequence
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETS
SEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRINKASLADSGEYMCKVISKLGN
DSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHLV
KCAEKEKTFCVNGGECFMVKDLSNPSRYLCK
Download sequence
Identical sequences Q7RTW5
gi|116006965|ref|NP_004486.2| NP_004486.2.87134 NP_004486.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]