SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116006967|ref|NP_039256.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116006967|ref|NP_039256.2|
Domain Number 1 Region: 251-346
Classification Level Classification E-value
Superfamily Immunoglobulin 2.98e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 359-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000225
Family EGF-type module 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116006967|ref|NP_039256.2|
Sequence length 422
Comment pro-neuregulin-1, membrane-bound isoform isoform GGF2 [Homo sapiens]
Sequence
MRWRRAPRRSGRPGPRAQRPGSAARSSPPLPLLPLLLLLGTAALAPGAAAGNEAAPAGAS
VCYSSPPSVGSVQELAQRAAVVIEGKVHPQRRQQGALDRKAAAAAGEAGAWGGDREPPAA
GPRALGPPAEEPLLAANGTVPSWPTAPVPSAGEPGEEAPYLVKVHQVWAVKAGGLKKDSL
LTVRLGTWGHPAFPSCGRLKEDSRYIFFMEPDANSTSRAPAAFRASFPPLETGRNLKKEV
SRVLCKRCALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQN
IKIQKKPGKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNATSTSTTGTSHL
VKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYSTSTPFLSL
PE
Download sequence
Identical sequences A0A2J8N843
ENSP00000434640 gi|116006967|ref|NP_039256.2| NP_039256.2.87134 NP_039256.2.92137 ENSP00000434640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]