SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116256451|ref|NP_694587.3| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116256451|ref|NP_694587.3|
Domain Number 1 Region: 250-438,547-589
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.29e-59
Family FAD-linked reductases, N-terminal domain 0.0034
Further Details:      
 
Domain Number 2 Region: 423-537
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.21e-25
Family L-aminoacid/polyamine oxidase 0.00025
Further Details:      
 
Weak hits

Sequence:  gi|116256451|ref|NP_694587.3|
Domain Number - Region: 193-246
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000663
Family SWIRM domain 0.021
Further Details:      
 
Domain Number - Region: 61-105
Classification Level Classification E-value
Superfamily RING/U-box 0.0141
Family RING finger domain, C3HC4 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116256451|ref|NP_694587.3|
Sequence length 590
Comment lysine-specific histone demethylase 1B [Homo sapiens]
Sequence
MATPRGRTKKKASFDHSPDSLPLRSSGRQAKKKATETTDEDEDGGSEKKYRKCEKAGCTA
TCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSN
GKTEPSPKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPE
TSDHCSLPEDLEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGAD
QYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTV
GRGAQIVNGCINNPVALMCEQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDI
QLKSPVQCIDYSGDEVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAIN
SLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSV
IAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKT
GGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
Download sequence
Identical sequences ENSP00000297792 NP_694587.3.87134 NP_694587.3.92137 9606.ENSP00000297792 gi|116256451|ref|NP_694587.3| ENSP00000297792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]