SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116268101|ref|NP_443138.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116268101|ref|NP_443138.2|
Domain Number 1 Region: 49-227
Classification Level Classification E-value
Superfamily L domain-like 1.19e-33
Family Ngr ectodomain-like 0.013
Further Details:      
 
Weak hits

Sequence:  gi|116268101|ref|NP_443138.2|
Domain Number - Region: 301-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.002
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116268101|ref|NP_443138.2|
Sequence length 820
Comment leucine-rich repeat and fibronectin type-III domain-containing protein 6 [Homo sapiens]
Sequence
MLRLGLCAAALLCVCRPGAVRADCWLIEGDKGYVWLAICSQNQPPYETIPQHINSTVHDL
RLNENKLKAVLYSSLNRFGNLTDLNLTKNEISYIEDGAFLGQSSLQVLQLGYNKLSNLTE
GMLRGMSRLQFLFVQHNLIEVVTPTAFSECPSLISIDLSSNRLSRLDGATFASLASLMVC
ELAGNPFNCECDLFGFLAWLVVFNNVTKNYDRLQCESPREFAGYPLLVPRPYHSLNAITV
LQAKCRNGSLPARPVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIK
LHHVTFTSATLVVIIPHPYSKMYILVQYNNSYFSDVMTLKNKKEIVTLDKLRAHTEYTFC
VTSLRNSRRFNHTCLTFTTRDPVPGDLAPSTSTTTHYIMTILGCLFGMVIVLGAVYYCLR
KRRMQEEKQKSVNVKKTILEMRYGADVDAGSIVHAAQKLGEPPVLPVSRMASIPSMIGEK
LPTAKGLEAGLDTPKVATKGNYIEVRTGAGGDGLARPEDDLPDLENGQGSAAEISTIAKE
VDKVNQIINNCIDALKLDSASFLGGGSSSGDPELAFECQSLPAAAAASSATGPGALERPS
FLSPPYKESSHHPLQRQLSADAAVTRKTCSVSSSGSIKSAKVFSLDVPDHPAATGLAKGD
SKYIEKGSPLNSPLDRLPLVPAGSGGGSGGGGGIHHLEVKPAYHCSEHRHSFPALYYEEG
ADSLSQRVSFLKPLTRSKRDSTYSQLSPRHYYSGYSSSPEYSSESTHKIWERFRPYKKHH
REEVYMAAGHALRKKVQFAKDEDLHDILDYWKGVSAQQKL
Download sequence
Identical sequences H2QLM0 Q5R3F8
NP_443138.2.87134 NP_443138.2.92137 XP_016794605.1.37143 XP_016794606.1.37143 XP_016794607.1.37143 XP_016794608.1.37143 XP_016794609.1.37143 XP_016794610.1.37143 XP_016794611.1.37143 ENSP00000300147 ENSP00000385277 gi|116268101|ref|NP_443138.2| 9606.ENSP00000300147 ENSP00000385277 ENSP00000480338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]