SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116284404|ref|NP_207837.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116284404|ref|NP_207837.2|
Domain Number 1 Region: 38-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 724-750,785-938
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.22e-38
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 338-520
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.21e-36
Family Laminin G-like module 0.0058
Further Details:      
 
Domain Number 4 Region: 153-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-35
Family Laminin G-like module 0.0044
Further Details:      
 
Domain Number 5 Region: 969-1173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-30
Family Laminin G-like module 0.022
Further Details:      
 
Domain Number 6 Region: 580-637
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000598
Family Fibrinogen C-terminal domain-like 0.0035
Further Details:      
 
Domain Number 7 Region: 551-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000173
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116284404|ref|NP_207837.2|
Sequence length 1308
Comment contactin-associated protein-like 4 isoform 1 [Homo sapiens]
Sequence
MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFAR
LNRRDGAGGWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNW
KQYRQEDSIWGFSGNANADSVVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYR
SEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTMQSDGILLHREGPNGDHITLQLRRAR
LFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
FNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQKPQIIAMGNV
SFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGIL
LFLSDGKLKSNLYQPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLL
GPEQIYSGGTYYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFS
DLQIDSCGISDRCLPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHR
GNTSGFYYIDSDGSGPLEPFLLYCNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYV
ASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNETQTYWGGSSPDLQ
KCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTGRLHSEAAYKL
GPLLCQGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFI
RIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQ
PAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRG
HCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLL
SKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSVIIAKNGSLQIRY
KLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEIDDNRRRQVHLSSGTEFSAVKS
LVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTES
SCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAI
AVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF
Download sequence
Identical sequences Q9C0A0
NP_207837.2.87134 NP_207837.2.92137 ENSP00000479811 gi|116284404|ref|NP_207837.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]