SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116292170|ref|NP_115543.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116292170|ref|NP_115543.2|
Domain Number 1 Region: 8-184
Classification Level Classification E-value
Superfamily RUN domain-like 4.97e-43
Family RUN domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|116292170|ref|NP_115543.2|
Domain Number - Region: 254-296
Classification Level Classification E-value
Superfamily eIF1-like 0.0238
Family eIF1-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116292170|ref|NP_115543.2|
Sequence length 375
Comment RUN domain-containing protein 2A [Homo sapiens]
Sequence
MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRS
RGLALTAAAIKQAAGFASKTETEPVFWYYVKEVLNKHELQRFYSLRHIASDVGRGRAWLR
CALNEHSLERYLHMLLADRCRLSTFYEDWSFVMDEERSSMLPTMAAGLNSILFAINIDNK
DLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILIKPEQETDPL
PVVSRNVSADAKCKKERKKKKKVTNIISFDDEEDEQNSGDVFKKTPGAGESSEDNSDRSS
VNIMSAFESPFGPNSNGSQSSNSWKIDSLSLNGEFGYQKLDVKSIDDEDVDENEDDVYGN
SSGRKHRGHSESPEK
Download sequence
Identical sequences gi|116292170|ref|NP_115543.2| 9606.ENSP00000268271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]